artesonraju

Wayne prefers it hard and dirty - his climbing, that is! Thanks for the spectacular photo!

Wow! You got some beautiful shots there. It's nice to see some shots from up high on Artesonraju. Wayne1112 and I climbed the peak back in 1997. Looks like you might have had better snow than we did - unconsolidated sugar for 90% of the face. Unfortunately I dropped my camera on the way down at about 18K, and watched it bounce for 2000'. Bye-bye summit shots! Thanks for the memories!

WOW! A typical CC.com mudslinging fest has devolved into a constructive interaction. Major props to all parties involved! Next thing you know, Rick Santorum will be advocating women's reproductive rights and environmental causes!

Wow Tom and friends, just awesome!

Great Job, Guys! Looks like a lot of fun!

Looks pretty awesome, Wayne!

So, where was everybody?!! All on the WA side? Soloed Bent Screw this morning after searching for partners from there to Ainsworth! Black Dagger looks fatter than when Wayne and I climbed it three years ago.

Looking for a ride to Washington Pass area. Climbing partner driving from Eastside 1. Late Thursday 7/3; Early Friday 7/4 2. Washington Pass 3. U District, Seattle 4. 1 5. Possible, but not desirable Call Wayne1112 @ 206-818-1327 (He doesn't have internet access right now.

Wayne, I think that you should add the epilogue to your Yosemite jail story - entering Canada almost 20 years later.

Just moved to Pullman from Portland, and I would love to see the area and get out climbing. I don't know what you had in mind, but give me a call at 503-880-4756 if you want to chat. Cheers, Lane I tried to send a PM, but it wouldn't go through.

LOCUS XM_421860 2854 bp mRNA linear VRT 16-NOV-2006 DEFINITION PREDICTED: Gallus gallus similar to hypothetical protein FLJ23861 (LOC424004), mRNA. ACCESSION XM_421860 VERSION XM_421860.2 GI:118093283 KEYWORDS . SOURCE Gallus gallus (red jungle fowl) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from an annotated genomic sequence (NW_001471728) using gene prediction method: GNOMON, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process On Nov 16, 2006 this sequence version replaced gi:50750076. FEATURES Location/Qualifiers source 1..2854 /organism="Gallus gallus" /mol_type="mRNA" /strain="inbred line UCD001" /isolate="#256" /db_xref="taxon:9031" /chromosome="7" /sex="female" /common="red jungle fowl" /note="inbred line derived from a wild population of red jungle fowl in Malaysia in the late 1930s, with the possible introgression of a limited amount of White Leghorn genome during its captive breeding history" gene 1..2854 /gene="LOC424004" /note="Derived by automated computational analysis using gene prediction method: GNOMON. Supporting evidence includes similarity to: 2 mRNAs, 5 ESTs, 1 Protein" /db_xref="GeneID:424004" CDS 107..2854 /gene="LOC424004" /codon_start=1 /product="hypothetical protein" /protein_id="XP_421860.2" /db_xref="GI:118093284" /db_xref="GeneID:424004" /translation="MESDTTLCMENSRAVEEKIKEDSIARITCSVLGFPTAEPSLRNN IFSVQHFASPPSSKHYQSVLLMSTNSALSSKTGKQMKSGEPDCSRMRNALHNGADASF GQISHSGPEEQVKGEAFSETTSPNLAETQRLLDSNVTESGNAEEVRLLNDKWYKKNGF LGRALGVCAETIKGDLLHQILHGPSEGILSCAREEVYARLLQCVTKQQMEISRAKRTQ KRLQMLLAKHVIKHCDQQLKCFVKHQFQRMKLLHKPARFSSSSSLRCADGWPENTAAT LGSSSSADVQNGVCVAPGEIRGFALSAGGLLSRVEKDLDSDATCSSSDEDYDEQTVRT AVEASYTSEWKWLADRARIGSRWTWLQAQISELEYKIQQLTDLHRQIRATKGMVILEE FPFPKDILKKQIQLTDQEALLNATGNSQAAIERQDSLPEHDFEMSPSSPTLLLRNIEK QSAQLSEIISSLIAPLNLSPASALSSKTCRHRQLVNGISFRASDNREVSSSSSWLLDH QHIKKRRRDRTRLRSFSVTNVSTSARTRPLHSFQKRKLYRMHGACDWNPQTSSFRDTS CPYRTQLPCVVPPSALSSSEYSPESKMLDYVQELDSSFHPVLSFPSDIPLHIYFETLL RKDDVKGEPVDASYPGVEFKIAPENDYNHHNVALKRWNNSCLSNSKSQSVSGTSEQLS EGRKKRHLSETAVGERNTRFETFSFQHAEPESPSSFAAVTNINAMSRPTHSTSSQHNS RRRLRSESSYDIDNIVIPMSLVAPSKLEKLQYKEILTPSWRVVELEPLERSHADEEEA EDLSDEVFSSRHTKYEERERARWSLWEQSRWPRRNSRSYGKNADGRHGQDSVQKDHPG SSCASLHCAAEPVPDLTSEAHSSVCSGIAQLRRESQEAKVGGSGSFQSVQDLSDLRFF S" ORIGIN 1 ggtttgctgt aaactgccta cagtagctat aatgacacca gccctcagag aggcagcaac 61 aaaaggtcat ggtatccact tgtcaccttc tttgtcctct agagctatgg agtctgatac 121 aactttgtgc atggaaaatt ccagagcagt ggaagagaag ataaaagagg actccattgc 181 acggattact tgctcagtcc tggggttccc cactgctgag cccagcctca ggaataatat 241 cttcagcgtg cagcattttg cttctccacc atcctccaag cactatcagt ctgtcttgtt 301 aatgagtacc aactctgcgc ttagcagcaa aaccggtaag caaatgaaat cgggagagcc 361 tgactgctcc aggatgagaa atgcattaca taatggcgcc gacgcatcgt ttggtcagat 421 cagtcattca ggacctgagg aacaggtcaa aggggaagct ttttcagaga ccacatctcc 481 gaatttggca gaaacgcaaa gacttttgga ttcgaatgta actgaatccg gcaacgcaga 541 agaagtgcgg ctcttaaatg ataaatggta caagaagaat ggttttttgg gtagggctct 601 gggagtctgc gccgaaacaa taaaagggga tttattacac caaattcttc acgggccttc 661 agaagggatt ttgagctgtg cccgggagga ggtgtacgct cgcttactcc agtgtgtcac 721 taagcaacaa atggagatca gccgcgccaa aagaactcag aaacgtttac aaatgctcct 781 ggcaaagcat gttatcaaac actgtgatca gcagctgaag tgcttcgtaa aacatcagtt 841 tcaaagaatg aagcttttac acaagccagc caggttttcg agcagtagct ccctcaggtg 901 tgcggacggt tggccagaaa acactgcagc tactttggga agtagttcga gtgcggatgt 961 acagaatgga gtctgtgttg caccggggga gatccggggg tttgcccttt ctgctggagg 1021 gctgctgtct cgtgtggaaa aggatctgga ctccgatgca acgtgtagca gctcagatga 1081 agactatgat gaacagactg taagaacagc tgtggaagcc agctatactt ctgaatggaa 1141 gtggcttgca gacagagcta gaattggcag ccgttggaca tggcttcaag cccagatttc 1201 agaactagaa tacaaaatcc aacaactaac tgaccttcac aggcagatac gtgccaccaa 1261 ggggatggtg atcttagaag aattcccatt tccaaaagac attttgaaga agcaaataca 1321 gttgacagac caagaagctt tattaaacgc cacagggaat tcgcaagctg ccattgagag 1381 acaggattct ttgccggagc atgactttga aatgtcaccc agcagtccta ccctgctttt 1441 acgaaacata gaaaaacaga gtgcacaact gagtgaaatc atcagtagcc tcattgctcc 1501 tctcaacctg tctccagctt ctgctctgtc atccaaaact tgcaggcaca gacagctggt 1561 caatggcatc tccttcaggg cttcagacaa cagagaagta tcctcttcga gcagctggtt 1621 gcttgatcat cagcacatca agaaaagaag aagagacagg acaagactaa ggtctttttc 1681 cgtgactaat gtcagcacat ctgccagaac aaggccactt cacagtttcc agaagagaaa 1741 actctacaga atgcacggtg cctgtgactg gaatccgcag acttcatcat ttagagatac 1801 ctcctgtccg tacagaactc agttaccatg tgtggtgcca ccctcagcat tgagcagtag 1861 tgagtacagt ccggaatcta aaatgctgga ctacgtgcaa gagctggact cttccttcca 1921 tccagtccta tcattccctt cagatattcc tcttcacata tactttgaaa cattattaag 1981 gaaggatgac gtcaagggag aacctgttga tgcctcatat cctggagtgg agtttaaaat 2041 agctccagaa aatgactata atcaccataa tgttgctctt aaacgatgga acaatagctg 2101 tttatctaat tccaaatctc aatcagtgtc aggaacatct gagcagctgt cggaaggaag 2161 aaagaaaaga catctaagtg agacagcagt gggcgaacgt aacaccaggt ttgagacgtt 2221 ctcctttcaa catgcagaac cagaatcccc tagcagtttt gcagccgtga ccaatatcaa 2281 tgcgatgtct aggcccactc acagcacttc atcacagcat aactccagga ggaggctgag 2341 aagtgagagc tcctatgata tagacaacat tgttattcca atgtcactgg tggcaccgtc 2401 aaagttggag aaactgcagt acaaagaaat cctgacgcca agctggagag ttgttgaatt 2461 agaacctttg gaaagatctc atgcagatga agaagaggca gaagatctgt cagatgaagt 2521 gttttcctca cgccatacca agtatgaaga aagagagcga gcgaggtggt cgctgtggga 2581 gcagagccgc tggcccagaa ggaacagcag atcgtacggc aaaaatgctg atggacgaca 2641 cggccaagat tcggtgcaga aggaccaccc cggcagctcc tgtgcctcgc tgcactgcgc 2701 tgctgaacct gttcccgacc tgacttctga agcccacagc tctgtttgtt cagggattgc 2761 acaactccgc agggagagcc aggaagcaaa ggtgggtggt tctggtagct tccagtccgt 2821 tcaggacttg agtgacctcc ggttctttag ctaa //

Thanks Oly. I guess that I didn't downsize it quite enough!

Now I know why I have never tried to add an image to my post before! I'll try again later, unless somebody wants to fix it for me.

An epitaph to the General. Sigh. We're all going to miss him. I will always remember the view of Washington Pass in his eyes. http://www.cascadeclimbers.com/plab/uploads/5559/WashingtonPassthrought_theEyesoftheGeneral_copy.jpg

Hi Everyone: Thanks for all of the advice; keep it coming. Fortunately, I am not single (but that is only temporary if I move, at least according to Mike). And, it seems like a great place to raise kids (at least until our girl turns 13 and becomes fodder for the lecherous WSU guys!). I am used to the 4+ hour commutes to Leavenworth and the North Cascades, and it does seem like that would change. Might be able to get in more trips to the Bugs and Canadian Rockies. Don't need that much night life, but I will miss the Portland restaraunts!